PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10033438
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 300aa    MW: 33361.7 Da    PI: 7.6782
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10033438genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.26.7e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd+ll ++++ +G g W+  +++ g++R++k+c++rw++yl
      Lus10033438 14 RGAWTAEEDQLLTRYIQSHGIGKWRNLPKKAGLNRCGKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding51.52.2e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ +++E++l+++++k+lG++ W++Ia +++ gRt++++k++w++ 
      Lus10033438  67 RGNISPDEEDLIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNTN 111
                      7899******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.137961IPR017930Myb domain
SuperFamilySSF466892.77E-3012108IPR009057Homeodomain-like
SMARTSM007178.4E-141363IPR001005SANT/Myb domain
PfamPF002497.8E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-241568IPR009057Homeodomain-like
CDDcd001673.82E-111661No hitNo description
PROSITE profilePS5129424.46662116IPR017930Myb domain
SMARTSM007171.3E-1566114IPR001005SANT/Myb domain
PfamPF002497.4E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-2469115IPR009057Homeodomain-like
CDDcd001674.51E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MGRSPCCSKE GMNRGAWTAE EDQLLTRYIQ SHGIGKWRNL PKKAGLNRCG KSCRLRWLNY  60
LRPDIKRGNI SPDEEDLIIR LHKLLGNRWS LIAGRLPGRT DNEIKNYWNT NLGKRVLLEN  120
RFPIPASSST CLTKPRSRKL MISTSSDAQL VTTKKYSFSD QQVIKTKALK CSSNQLLFYQ  180
QPNLAMGKRS NNIDTLETSS SNELSCVDGT SSNSHTNNAL HEGSDELIMT MDFGAGPEIS  240
LSDLLLGCED GLRDLCDFNM INSSSSSKGT DPELLISSEE MLDEATWNNI DVIDHQAAA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-271211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003541301.11e-78PREDICTED: transcription factor MYB23-like
TrEMBLI6Q1B77e-81I6Q1B7_9FABA; Tannin-related R2R3 MYB transcription factor
STRINGGLYMA13G16890.13e-78(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.11e-62myb domain protein 3